PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC7158_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family SBP
Protein Properties Length: 384aa    MW: 43112.9 Da    PI: 8.2734
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC7158_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.93.8e-40168244177
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 +Cq++gC+ dls+ak+yhr+h+vCe hsk+p+v+v g+e+rfCqqCsrfh++sefDe+krsCr+rL++hn+rrrk+q
  RrC7158_p2 168 RCQIDGCQLDLSSAKDYHRKHRVCENHSKCPKVTVGGVERRFCQQCSRFHAVSEFDETKRSCRKRLSHHNARRRKPQ 244
                 6**************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.7E-32162230IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.171166243IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.53E-37167244IPR004333Transcription factor, SBP-box
PfamPF031109.6E-31169242IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MDCNMRSPFL WDLEHLILPN PSESVNDKDQ LTTTTEWETD KGEGIESILP CFNGLERVSS  60
LWDTPVSKSS QSTSTNSSSP QPKQRMLASE ASPRSSNIDL VQVKAPPTAL DASPESDLSL  120
KLGKRTYSEE LWGGRNNNNN NDISAVSVKL LTRKKSKASC GQSIQVPRCQ IDGCQLDLSS  180
AKDYHRKHRV CENHSKCPKV TVGGVERRFC QQCSRFHAVS EFDETKRSCR KRLSHHNARR  240
RKPQGVFPFN PDRVYDGRQH TNMLWNGLSL NTRSEEKFAW DDTYDTKPTQ TESGFTLSFQ  300
RGNGSEQQMF ASNNHSFSAY QTSAGKPKFQ LHGQGGVGEY SGVLHESQDF HRALSLLSTS  360
SDPMMVQPHT QPFSLLFSYD GVPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-261692421184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00161DAPTransfer from AT1G27360Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3533921e-175AK353392.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-42-E20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013598135.10.0PREDICTED: squamosa promoter-binding-like protein 11
RefseqXP_013598136.10.0PREDICTED: squamosa promoter-binding-like protein 11
RefseqXP_013598137.10.0PREDICTED: squamosa promoter-binding-like protein 11
RefseqXP_013598138.10.0PREDICTED: squamosa promoter-binding-like protein 11
SwissprotQ9FZK00.0SPL11_ARATH; Squamosa promoter-binding-like protein 11
TrEMBLA0A078FTQ20.0A0A078FTQ2_BRANA; BnaA07g08840D protein
STRINGBra030040.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50041653
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27360.41e-176squamosa promoter-like 11